SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000006363 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000006363
Domain Number 1 Region: 78-168
Classification Level Classification E-value
Superfamily WWE domain 8.11e-30
Family WWE domain 0.00093
Further Details:      
 
Domain Number 2 Region: 5-90
Classification Level Classification E-value
Superfamily WWE domain 3.4e-25
Family WWE domain 0.00068
Further Details:      
 
Domain Number 3 Region: 389-492
Classification Level Classification E-value
Superfamily RING/U-box 1.16e-19
Family RING finger domain, C3HC4 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000006363   Gene: ENSPTRG00000003688   Transcript: ENSPTRT00000006898
Sequence length 619
Comment pep:known scaffold:CHIMP2.1.4:GL391837.1:5134238:5172826:1 gene:ENSPTRG00000003688 transcript:ENSPTRT00000006898 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLASAVVVWEWLNEHGRWRPYSPAVSHHIEAVVRAGPRAGGSVVLGQVDSRLAPYIIDL
QSMNQFRQDTGTLRPVRRNYYDPSSAPGKGVVWEWENDNGSWTPYDMEVGITIQHAYEKQ
HPWIDLTSIGFSYVIDFNTMGQINRQTQRQRRVRRRLDLIYPMVTGTLPKAQSWPVSPGP
ATSPPMSPCSCPQCVLVMSVKAAVVNGSTGPLQLPVTRKNMPPPGVVKLPPPPGSGAKPL
DSTGTIRGPLKTTPSQVIRRQASSMPTGTTMGSPASPPGPNSKTGRVALATLNRTNLQRL
AIAQSRVLIASGVPTVPVKNLNGSSPVNPALAGITGILMSAAGLPVCLTRPPKLVLHPPP
VSKSEIKSIPGVSNTSRKTTKKQAKKGKTPEEVLKKYLQKVRHPPDEDCTICMERLTAPS
GYKGPQPTVKPDLVGKLSRCGHVYHIYCLVAMYNNGNKDGSLQCPTCKTIYGVKTGTQPP
GKMEYHLIPHSLPGHPDCKTIRIIYSIPPGIQGPEHPNPGKSFSARGFPRHCYLPDSEKG
RKVLKLLLVAWDRRLIFAIGTSSTTGESDTVIWNEVHHKTEFGSNLTGHGYPDANYLDNV
LAELAAQGISEDSTAQEKD
Download sequence
Identical sequences H2Q3Q7
ENSPTRP00000006363 ENSPTRP00000006363 XP_009438753.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]