SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000006540 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000006540
Domain Number 1 Region: 45-182
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.9e-42
Family Galectin (animal S-lectin) 0.00019
Further Details:      
 
Domain Number 2 Region: 209-335
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.18e-18
Family Galectin (animal S-lectin) 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000006540   Gene: ENSPTRG00000003803   Transcript: ENSPTRT00000007088
Sequence length 336
Comment pep:known chromosome:CHIMP2.1.4:11:61423546:61434278:1 gene:ENSPTRG00000003803 transcript:ENSPTRT00000007088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQPSGGRAPGTRIYSWSCPTVMSPGEKLDPIPDSFILQPPVFHPVVPYVTTIFGGLRAG
KMVVLQGVVPLDAHRFQVDFQCGCSLCPRPDIAFHFNPRFHTTKPHVICNTLHGGRWQRE
ARWPHLPLRRGSSFLILFLFGNEEVKVSVNGQHFLHFRYRLPLSHVDTLGIFGDILVEAV
GFLNINPFVEGSREYPAGHPFLLMSPRLEVPCSHALPQGLSPGQVIIVRGLVLQEPKHFT
VSLRDQAAHAPVTLRASFADRTLAWISRWGQKKLISAPFLFYPQRFFEVLLLFQEGGLKL
ALNGQGLGATSMNQQALEQLRELRISGSVQLYCVHS
Download sequence
Identical sequences H2Q3Y1
ENSPTRP00000006540 ENSPTRP00000006540 XP_001161075.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]