SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000008093 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000008093
Domain Number 1 Region: 861-1209
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.75e-87
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.00000141
Further Details:      
 
Domain Number 2 Region: 688-857
Classification Level Classification E-value
Superfamily ARM repeat 7e-45
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.00063
Further Details:      
 
Domain Number 3 Region: 530-665
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.29e-20
Family PLC-like (P variant) 0.027
Further Details:      
 
Domain Number 4 Region: 1242-1343
Classification Level Classification E-value
Superfamily PX domain 4.58e-18
Family PX domain 0.0048
Further Details:      
 
Domain Number 5 Region: 1371-1478
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000818
Family Synaptotagmin-like (S variant) 0.012
Further Details:      
 
Domain Number 6 Region: 230-354
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000148
Family Ras-binding domain, RBD 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000008093   Gene: ENSPTRG00000004741   Transcript: ENSPTRT00000008757
Sequence length 1481
Comment pep:novel chromosome:CHIMP2.1.4:12:18590943:18982939:1 gene:ENSPTRG00000004741 transcript:ENSPTRT00000008757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYSWQTDPNPNESHEKQYEHQEFLVVNQPHSSSQVSLGFDQIVDEISGKIPHYESEIDE
NNFFVPTAPKWDSTGHSLNEAHQISLNEFTSKSRELSWHQVRKAPAIGFSPSVLPKPQNM
NKECSWGSPIGKHHGADDSRFSILAPSFTSLDKINLEKELENENYNYHIGFESSIPPTNS
SFSSDFMPKEENKRSGHVNIVEPSLMLLKGSLQPRMWESTWQKNIESIGCSIQLVEVPQS
SNTSLASFCNKVKKIRERYHAADVNFNSGKIWSTTTAFPYQLFSKTKFNIHIFIDNSTQP
LHFMPCANDLVKDLIAEILHFCTNDQLLPKDHILSVCGSEEFLQNDHCLGSHKMFQDKSV
IQLLQKRAPGKLSRKHEEDHSQFYLNQLLEFMHIWKVSRQCLLTLIRKYDFHLKYLLKTQ
ENVDNIIEEVKKICSVLGCVETKQITDAVNELSLILQRKAENFYQSSETSAKGLIEKVTT
ELSTSIYQLINVYCNSFYADFQPVNVPRCISYLNPGLPSHLSFTVYAAHNIPETWVHSYK
AFSFTCWLTYAGKKLCQVRNYRNFPVKKLFFFLVNWNETINFPLEIKSLPRESMLTVKLF
GIACATNNANLLAWTCLPLFPKEKSILGSMLFSMTLQSEPPIEMIAPGVWDVSQPSPVTL
QIDFPATGWEYMKPDSEENRSNLEEPLKECIKHIARLSQKQTPLLLSEEKKRYLWFYRFY
CNNENCSLPLVLGSAPGWDERTVSEMHTILRRWTFSQPLEALGLLTSSFPDQEIRKVAVQ
QLDNLLNDELLEYLPQLVQAVKFEWNLESPLVQLLLHRSLQSIQVAHRLYWLLKNAENEA
YFKSWYQKLLAALQFCAGKALNDEFSKEQKLIKILGDIGEKVKSASDHQRQEALKKEISR
LEEFFQDVNTCHLPLNPALCIKGIDHDACSYFTSNALPLKITFINANPMGKNISIIFKAG
DDLRQDMLVLQIIQVMDNIWLQEGLDMQMIIYRCLSTGKDQGLVQMVPDAVTLAKIHRHS
GLIGPLKENTIKKWFSQHNHLKADYEKALRNFFYSCAGWCVVTFILGVCDRHNDNIMLTK
SGHMFHIDFGKFLGHAQTFGGIKRDRAPFIFTSEMDYFITEGGKNPQHFQDFVELCCRAY
NIIRKHSQLLLNLLEMMLYPRGPELSGILLTRKYVYNNLRPQTREATSHFTKKIKESLEC
FPVKLNNLIHTLAQMSAISPARSTSQTFPQESCLLSTTRSIERATILGFSKKSSNLYLIQ
VTHSNNETSLTEKSFEQFSKLHSQLQKQFASLTLPEFPHWWHLPFTNSDHRRFRDLNHYM
EQILNGSHEVTNSDCVLSFFLSEAVQQTVEESSLVYLGEKFPDKKPKVQLVISYKDVKLT
ILVKHMKNIHLPDGSAPSAHVEFYLLPYPSEVRRRKTKSVPKCTDPTYNEIVVYDEVTEL
QGHVLMLIVKSKTVFVGAINIRLCSVPLDEEKWYPLGNSII
Download sequence
Identical sequences ENSPTRP00000008093 ENSPTRP00000008093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]