SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000008292 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000008292
Domain Number 1 Region: 80-278
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.68e-42
Family Laminin G-like module 0.0031
Further Details:      
 
Domain Number 2 Region: 482-530
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000101
Family EGF-type module 0.016
Further Details:      
 
Domain Number 3 Region: 318-382
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000314
Family VWC domain 0.016
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000008292
Domain Number - Region: 383-448
Classification Level Classification E-value
Superfamily FnI-like domain 0.000324
Family VWC domain 0.091
Further Details:      
 
Domain Number - Region: 448-482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00198
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000008292   Gene: ENSPTRG00000004848   Transcript: ENSPTRT00000008979
Sequence length 539
Comment pep:known chromosome:CHIMP2.1.4:12:44541075:44751242:1 gene:ENSPTRG00000004848 transcript:ENSPTRT00000008979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFPPLLKGQASATRSSLASCSWVVFFLSCLSRHAPEIEGGRRWTELIRTMESRVLLRTF
CLIFGLGAVWGLGVDPSLQIDVLTELELGESTTGVRQVPGLHNGTKAFLFQDTPRSIKAS
TATAEQFFQKLRNKHEFTILVTLKQTHLNSGVIISIHHLDHRYLELESSGHRNEVRLHYR
SGSHRPHTEVFPYILADDKWHKLSLAISASHLILHIDCNKIYERVVEKPSTDLPLGTTFW
LGQRNNAHGYFKGIMQDVQLLVMPQGFIAQCPDLNRTCPTCNDFHGLVQKIMELQDILAK
TSAKLSRAEQRMNRLDQCYCERTCTMKGTTYREFESWIDGCKNCTCLNGTIQCETLICPN
PDCPLKSALAYVDGKCCKECKSICQFQGRTYFEGERNTVYSSSGVCVLYECKDQTMKLVE
NSGCPALDCPESHQITLSHSCCKVCKGYDFCSERRNCMENSVCRNLNDRAVCSCRDGFRA
LREDNAYCEDIDECAEGRHYCRENTMCVNTPGSFMCICKTGYIRIDDYSCTGKRWLFVK
Download sequence
Identical sequences ENSPTRP00000008292 ENSPTRP00000008292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]