SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000009298 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000009298
Domain Number 1 Region: 95-185
Classification Level Classification E-value
Superfamily WWE domain 3.4e-28
Family WWE domain 0.0013
Further Details:      
 
Domain Number 2 Region: 23-106
Classification Level Classification E-value
Superfamily WWE domain 1.7e-25
Family WWE domain 0.0013
Further Details:      
 
Domain Number 3 Region: 371-475
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000002
Family RING finger domain, C3HC4 0.0000384
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000009298
Domain Number - Region: 228-238
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0196
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000009298   Gene: ENSPTRG00000005480   Transcript: ENSPTRT00000010060
Sequence length 600
Comment pep:novel chromosome:CHIMP2.1.4:12:113545371:113587310:1 gene:ENSPTRG00000005480 transcript:ENSPTRT00000010060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRPGHGGLMPVNGLGFPPQNVARVVVWEWLNEHSRWRPYTATVCHHIENVLKEDARGSV
VLGQVDAQLVPYIIDLQSMHQFRQDTGTMRPVRRNFYDPSSAPGKGIVWEWENDRGAWTA
YDMDICITIQNAYEKQHPWLDLSSLGFCYLIYFNSMSQMNRQTRRRRRLRRRLDLAYPLT
VGSIPKSQSWPVGASSGQPCSCQQCLLVNSTRAASNAILASQRRKAPPAPPLPPPPPPGG
PPGALAVRPSATFTGAALWAAPAAGPAEPAPPPGAPPRSPGAPGGARTPGQNNLNRPGPQ
RTTSVSARASIPPGVPALPVKNLNGTGPVHPALAKPILHPPPVSKSDVKPVPGVPGVCRK
TKKKHLKKSKNPEDVVRRYMQKVKNPPDEDCTICMERLVTASGYEGVLRHKGVRPELVGR
LGRCGHMYHLLCLVAMYSNGNKDGSLQCPTLQAIYGEKTGTQPPGKMEFHLIPHSLPGFP
DTQTIRIVYDIPTGIQGPEHPNPGKKFTARGFPRHCYLPNNEKGRKVLRLLITAWERRLI
FTIGTSNTTGESDTVVWNEIHHKTEFGSNLTGHGYPDASYLDNVLAELTAQGVSEAAAKA
Download sequence
Identical sequences ENSPTRP00000009298 ENSPTRP00000009298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]