SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000010802 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000010802
Domain Number 1 Region: 275-383
Classification Level Classification E-value
Superfamily SH2 domain 2.15e-25
Family SH2 domain 0.000000557
Further Details:      
 
Domain Number 2 Region: 387-427
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000000327
Family SOCS box-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000010802   Gene: ENSPTRG00000006368   Transcript: ENSPTRT00000011665
Sequence length 440
Comment pep:known chromosome:CHIMP2.1.4:14:53990809:54013445:1 gene:ENSPTRG00000006368 transcript:ENSPTRT00000011665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAENNENISKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESYSDAETVNGIEKTEV
SLRNQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSSRHSSGLPSKR
KIHISELMLDKCPFPPRSDLAFRWHFIKRHTAPINSKSDEWVSTDLSQTELRDGQLKRRN
MEENINCFSHTNVQPCVITTDNALCREGPMTGSVMNLVSNNSIEDSDMDSDDEILTLCTS
SRKRNKPKWELDDEILQLETPPKYHTQIDYVHCLVPDLLQINNNPCYWGVMDKYAAEALL
EGKPEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDITGL
LEHYKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPIPSSMKLYLK
EYHYKSKVRVLRIDAPEQQC
Download sequence
Identical sequences A0A2I2YLM9
ENSGGOP00000024578 ENSPTRP00000010802 XP_003831738.1.60992 XP_003831739.1.60992 XP_008955296.1.60992 XP_008955297.1.60992 XP_008955298.1.60992 XP_018865688.1.27298 XP_018865689.1.27298 9598.ENSPTRP00000010802 ENSPTRP00000010802 ENSGGOP00000024578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]