SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000012048 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000012048
Domain Number 1 Region: 159-347
Classification Level Classification E-value
Superfamily PH domain-like 1.84e-58
Family Phosphotyrosine-binding domain (PTB) 0.000000351
Further Details:      
 
Domain Number 2 Region: 511-612
Classification Level Classification E-value
Superfamily SH2 domain 6.73e-26
Family SH2 domain 0.0000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000012048   Gene: ENSPTRG00000007048   Transcript: ENSPTRT00000013009
Sequence length 630
Comment pep:known chromosome:CHIMP2.1.4:15:46008772:46148986:-1 gene:ENSPTRG00000007048 transcript:ENSPTRT00000013009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRERGQDSLAGLVLYVGLFGHPGMLHRAKYSRFRNESITSLDEGSSGGSVGNKGSPQPPH
PALPPHLPTEDATLPSQESPTPLCTLIPRMASMKLANPATLLSLKNFCLGTKEVPRLKLQ
ESRDPGSSGPSSPETSLSRSGTAPPPQQDLVGHRATALTPDSCPLPGPGEPTLRSRQDRH
FLQHLLGMGMNYCVRYMGCIEVLQSMRSLDFGMRTQVTREAISRLCEAVPGANGAIKKRK
PPVKFLSTVLGKSNLQFSGMNIKLTISTCSLTLMNLDNQQIIANHHMQSISFASGGDPDT
TDYVAYVAKDPVNQRACHILECHNGMAQDVISTIGQAFELRFKQYLKNPSLNTSCESEEV
HIDSHAEEREDHEYYNEIPGKQPPVGGVSDMRIKVQATEQMAYCPIQCEKLCYLPGNSKC
SSVYENCLEQSRAIGNVHPRGVQSQRDTSLLKHTCRVDLFDDPCYINTQALQSTPGSAGN
QSSAQPLGSPWHCRKAPETVQPGATAQPASSHSLPHIKQQLWSEECYHGKLSRKAAESLL
VKDGDFLVRESATSPGQYVLSGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIRYHMDN
SLPIISSGSEVSLKQPVRKDNNPALLHSNK
Download sequence
Identical sequences H2Q9E1
9598.ENSPTRP00000012048 ENSPTRP00000012048 ENSPTRP00000012048 XP_003831535.1.60992 XP_016783669.1.37143 XP_510385.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]