SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000013399 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000013399
Domain Number 1 Region: 228-380
Classification Level Classification E-value
Superfamily Ribonuclease H-like 4.83e-26
Family DnaQ-like 3'-5' exonuclease 0.001
Further Details:      
 
Domain Number 2 Region: 505-664
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.85e-16
Family Canonical RBD 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000013399   Gene: ENSPTRG00000007851   Transcript: ENSPTRT00000014466
Sequence length 774
Comment pep:known chromosome:CHIMP2.1.4:16:20631044:20674184:1 gene:ENSPTRG00000007851 transcript:ENSPTRT00000014466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPEREGTERHPRKVRERRQAPNKLVGAAEAMKAGWDLEESQPEAKKARLSTILFTDNCE
VSHDQLCELLKYAVLGKSNVPKPSWCQLFHQNHLNNVVVFVLQGMSQLHFYRFYLEFGCL
RKAFRHKFRLPPPSSDFLADVVGLQTEQRAGDLPKTMEEPLPSNAKAAINLQDDPIIQKY
GSKKVGLTRCLLTKEEMRTFHFPLQGFPDCENFLLTKCNGSIADNSPLFGLDCEMCLTSK
GRELTRISLVAEGGCCVMDELVKPENKILDYLTSFSGITKKILNPVTTKLKDVQRQLKAL
LPPDAVLVGHSLDLDLRALKMIHPYVIDTSLLYVREQGRRFKLKFLAKVILGKDIQCPDR
LGHDATEDARTILELAEYFLKHGPKKIAELNLEALANHQEIQAAGQEPKNTAEVLQHPNT
SVLECLDSVGQKLLFLTRETDAGELPSSRNCQTIKCLSNKEVLEQARVEIPLFPFSIVQF
SFKAFSPVLTEEMNKRMRIKWTEISTVYAGPFSKNCNLRALKRLFKSFGPVQSMTFVLET
RQPHLCIQYEVLEAAQLAIESLDGILVDGICIKVQRPVTELTLDCDTLVNELEGDSENQG
SIYLSGVSETFKEQLLQEPRLFLGLEAVILPKDLKSGKQKKYCFLKFKSFGSAQQALNIL
TGKDWKLKGRHALTPRHLHAWLRGLPPESTRLPGLRVVPPPFEQEALQTLKLDHPKVAAW
RWSRKIGKLYNSLCPGTLCLILLPGTKSTHGSLSGLGLMGIKEEEESTGPGLCS
Download sequence
Identical sequences G2HG75
NP_001233411.1.37143 XP_003812115.1.60992 XP_003812116.1.60992 XP_008962711.1.60992 XP_009428664.1.37143 XP_009428665.1.37143 ENSPTRP00000013399 9598.ENSPTRP00000013399 ENSPTRP00000013399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]