SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000014752 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000014752
Domain Number 1 Region: 3-119
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.83e-29
Family Txnl5-like 0.00000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000014752   Gene: ENSPTRG00000008644   Transcript: ENSPTRT00000015945
Sequence length 123
Comment pep:known chromosome:CHIMP2.1.4:17:6671942:6675581:1 gene:ENSPTRG00000008644 transcript:ENSPTRT00000015945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHI
SEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLF
SED
Download sequence
Identical sequences A0A140VJY7 A0A2I3H5Q4 G3QKM5 H2QC11 Q9BRA2
1wou_A ENSNLEP00000011250 ENSP00000250101 ENSGGOP00000003003 ENSP00000250101 ENSPTRP00000014752 ENSGGOP00000003003 1wouA 9598.ENSPTRP00000014752 9606.ENSP00000250101 ENSNLEP00000011250 gi|14249348|ref|NP_116120.1| ENSPTRP00000014752 cath|current|1wouA00/4-122 ENSP00000250101 NP_116120.1.87134 NP_116120.1.92137 XP_003274631.1.23891 XP_003810187.1.60992 XP_004058471.1.27298 XP_511988.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]