SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000015217 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000015217
Domain Number 1 Region: 149-296,335-350,430-472
Classification Level Classification E-value
Superfamily Hemopexin-like domain 8.4e-54
Family Hemopexin-like domain 0.00055
Further Details:      
 
Domain Number 2 Region: 21-67
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000000196
Family Somatomedin B domain 0.0000505
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000015217   Gene: ENSPTRG00000008916   Transcript: ENSPTRT00000016445
Sequence length 478
Comment pep:known chromosome:CHIMP2.1.4:17:28714098:28717177:1 gene:ENSPTRG00000008916 transcript:ENSPTRT00000016445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPLRPLLILALLAWVALADQESCKGRCTEGFNADKKCQCDELCSYYQSCCTDYTAECKP
QVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSEGNPEQTPVLKPEE
EAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYC
YELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYP
RNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSA
VFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMA
PRPSLAKKQKFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDY
RMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL
Download sequence
Identical sequences H2QCH3
XP_001146856.1.37143 ENSPTRP00000015217 ENSPTRP00000015217 9598.ENSPTRP00000015217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]