SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000015965 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000015965
Domain Number 1 Region: 23-316
Classification Level Classification E-value
Superfamily L domain-like 1.09e-56
Family Ngr ectodomain-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000015965   Gene: ENSPTRG00000009400   Transcript: ENSPTRT00000017244
Sequence length 359
Comment pep:known chromosome:CHIMP2.1.4:17:49055885:49060229:-1 gene:ENSPTRG00000009400 transcript:ENSPTRT00000017244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRPMLLLSLGLLAGLLPALAACPQNCHCHGDLQHVICDKVGLQKIPKVSEKTKLLNLQR
NNFPVLAANSFRAMPNLVSLHLQHCQIREVAAGAFRGLKQLIYLYLSHNDIRVLRAGAFD
DLTELTYLYLDHNKVTELPRGLLSPLVNLFILQLNNNKIRELRAGAFQGAKDLRWLYLSE
NALSSLQPGALDDVENLAKFHVDRNQLSSYPSAALSKLRVVEELKLSHNPLKSIPDNAFQ
SFGRYLETLWLDNTNLEKFSDGAFLGVTTLKHVHLENNRLNQLPSNFPFDSLETLALTNN
PWKCTCQLRGLRRWLEAKASRPDATCASPAKFKGQHIRDTDAFRSCKFPTKRSKKAGRH
Download sequence
Identical sequences G3QUH5 H2QDF2
ENSPTRP00000015965 ENSGGOP00000006377 XP_001170009.4.37143 XP_009431089.2.37143 XP_016787992.1.37143 ENSGGOP00000006377 9598.ENSPTRP00000015965 ENSPTRP00000015965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]