SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000017771 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000017771
Domain Number 1 Region: 37-98
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.35e-25
Family KRAB domain (Kruppel-associated box) 0.00066
Further Details:      
 
Domain Number 2 Region: 456-513
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-25
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 289-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.36e-23
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 4 Region: 344-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.93e-23
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 5 Region: 400-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.03e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 498-550
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.81e-19
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 7 Region: 174-184,215-252
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000431
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 8 Region: 140-185
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000007
Family Classic zinc finger, C2H2 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000017771   Gene: ENSPTRG00000010447   Transcript: ENSPTRT00000019201
Sequence length 554
Comment pep:novel chromosome:CHIMP2.1.4:19:9715979:9726548:-1 gene:ENSPTRG00000010447 transcript:ENSPTRT00000019201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVDLSHGHYLSGDPVCLHEEKTPAGRIVADCLTDCYQDSVTFDDVAVDFTQEEWTLLD
STQRSLYSDVMLENYKNLATVGGQIIKPSLISWLEQEESRTVQGGVLQGWEMRLETQWST
LQQDFLRGQTSIGIQLEGKHNGGELCDCEQCGEVFSEHSCLKTHVRTQSTGNTHDCNQYG
KDFLTLHEKTSTGEKLSEFNQSEKIFSLTPNIVYQRTSTQEKSFECSHCGKSFINESYLQ
AHMRTHDGEKLYEWRNYGPGFIDSTSLSVLIETLNAKKPYKCKECGKGYRYPAYLSIHMR
THTGEKPYECKECGKAFNYSNSFQIHGRTHTGEKPYVCKECGKAFTQYSGLSMHVRSHSG
DKPYECKECGKSFLTSSRLIQHIRTHTGEKPFVCVECGKAFAVSSNLSGHLRTHTEEKAC
ECKICGKVFGYPSCLNNHMRTHSAQKPYTCKECGKAFNYSTHLKIHMRIHTGEKPYECKQ
CGKAFSHSSSFQIHERTHTGEKPYECKECGKAFTCSSSFRIHEKTHTEEKPYKCQQCGKA
YSHPRSLRRHEQIH
Download sequence
Identical sequences A0A2I3STQ8
ENSPTRP00000017771 ENSPTRP00000017771 XP_016790435.1.37143 XP_016790436.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]