SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000019235 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000019235
Domain Number 1 Region: 387-524
Classification Level Classification E-value
Superfamily CalX-like 1.27e-31
Family CalX-beta domain 0.000008
Further Details:      
 
Domain Number 2 Region: 516-625
Classification Level Classification E-value
Superfamily CalX-like 0.000000000000144
Family CalX-beta domain 0.0000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000019235   Gene: ENSPTRG00000011209   Transcript: ENSPTRT00000020829
Sequence length 872
Comment pep:known chromosome:CHIMP2.1.4:19:52366172:52402065:-1 gene:ENSPTRG00000011209 transcript:ENSPTRT00000020829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPLALVGVTLLLAAPPCSGAATPTPSLPPPPANDSDTSTGGCQGSYRCQPGVLLPVWEP
DDPSLGDKAARAVVYFVAMVYMFLGVSIIADRFMAAIEVITSKEKEITITKANGETSVGT
VRIWNETVSNLTLMALGSSAPEILLSVIEVCGHNFQAGELGPGTIVGSAAFNMFVVIAVC
IYVIPAGESRKIKHLRVFFVTASWSIFAYVWLYLILAVFSPGVVQVWAVTVFSPVCVVAW
MATKRLYKVYKGSRTDPRSGIIIGAEGDPPKSIELDGTFVGAEAPGELGGLGPGPAEARE
LDASRREVIQILKDLKQKHPDKDLEQLVGIANYYALLHQQKSRAFYRIQATRLMTGAGNV
LRRHAADASRRAAPAEGAGEDEDDGASRIFFEPSLYHCLENCGSVLLSVTCQGGEGNSTF
YVDYRTEDGSAKAGSDYEYSEGTLVFKPGETQKELRIGIIDDDIFEEDEHFFVRLLNLRV
GDAQGMFEPDGGGRPKGRLVAPLLATVTILDDDHAGIFSFQDRLLHVSECMGTVDVRVVR
SSGARGTVRLPYRTVDGTARGGGVHYEDACGELEFGDDETDGDRKLTAEEEEARRIAEMG
KPVLGENCRLEVIIEESYDFKNTVDKLIKKTNLALVIGTHSWREQFLEAITVSAGDEEEE
EDGSREERLPSCFDYVMHFLTVFWKVLFACVPPTEYCHGWACFGVSILVIGLLTALIGDL
ASHFGCTVGLKDSVNAVVFVALGTSIPDTFASKVAALQDQCADASIGNVTGSNAVNVFLG
LGVAWSVAAVYWAVQGRPFEVRTGTLAFSVTLFTVFAFVGIAVLLYRRRPHIGGELGGPR
GPKLATTALFLGLWLLYILFASLEAYCHIRGF
Download sequence
Identical sequences ENSPTRP00000019235 ENSPTRP00000019235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]