SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000019574 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000019574
Domain Number 1 Region: 381-437
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.12e-26
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 2-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.59e-26
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 3 Region: 240-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.22e-24
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 4 Region: 297-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.84e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 437-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.38e-21
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 6 Region: 478-530
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.14e-19
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 7 Region: 202-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.16e-19
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 8 Region: 343-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000069
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000019574
Domain Number - Region: 168-213
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000405
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000019574   Gene: ENSPTRG00000022586   Transcript: ENSPTRT00000021200
Sequence length 617
Comment pep:known chromosome:CHIMP2.1.4:19:56828625:56838162:1 gene:ENSPTRG00000022586 transcript:ENSPTRT00000021200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIKSQESLALEDVAVEFTWEEWQLLGPAQKDLYRDVMLENYSNLVSVGYQASKPDALFKL
EQGEPWTVENEIHSQICPEIKKVDNHLQMHSQKQRCLKRVEQCHKHNAFGNIIHQRKSDF
PLRQNHDTFDLHGKILKSNLSLVNQNKRYEIENSVGVNGDGKSFLHAKHEQFHNEMNFPE
GGNSVNTNSQFIKHQRTQNIDKPHVCTECGKAFLKKSRLIYHQRVHTGEKPHGCSICGKA
FSRKSGLTEHQRNHTGEKPYECTECDKAFRWKSQLNAHQKIHTGEKSYICSDCGKGFIKK
SRLINHQRVHTGEKPHGCSLCGKAFSKRSRLTEHQRTHTGEKPYECTECDKAFRWKSQLN
AHQKAHTGEKSYICRDCGKGFIQKGNLIVHQRIHTGEKPYICNECGKGFIQKGNLLIHRR
THTGEKPYVCNECGKGFSQKTCLISHQRFHTGKTPFVCTECGKSCSHKSGLINHQRIHTG
EKPYTCSDCGKAFRDKSCLNRHRRTHTGERPYGCSDCGKAFSHLSCLVYHKGMLHAREKC
VGSVKLENPCSESRSLSHTRDLIQDKDSVNMVTLQMPSVAAQTSLTNSAFQAESKVAIVS
QPVARSSVSADSRICTE
Download sequence
Identical sequences H2QH12
9598.ENSPTRP00000019574 ENSPTRP00000019574 ENSPTRP00000019574 XP_003316634.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]