SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000019597 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000019597
Domain Number 1 Region: 5-586
Classification Level Classification E-value
Superfamily ARM repeat 1.18e-111
Family HEAT repeat 8.93e-16
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000019597   Gene: ENSPTRG00000011406   Transcript: ENSPTRT00000021227
Sequence length 589
Comment pep:known chromosome:CHIMP2.1.4:19:57091386:57127733:1 gene:ENSPTRG00000011406 transcript:ENSPTRT00000021227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIY
DEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHS
PSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPM
VRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDL
EALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRA
AASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDN
TIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVR
LAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHA
TIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNV
AKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA
Download sequence
Identical sequences A0A0A0MWP4 A0A0D9S5A4 A0A2J8U9M5 A0A2K5JLU7 A0A2K5N9Q3 A0A2K5QGN2 A0A2K5Y6H5 A0A2K6CBT5 A0A2K6KFG8 A0A2K6QPU0 A0A2K6UA26 A8K7B7 F6RRV0 F7H4K0 G3QUV4 H2QH17 P30153 Q4R4Y6
ENSPTRP00000019597 ENSGGOP00000006514 ENSGGOP00000006514 ENSP00000324804 cath|current|2ie3A00/9-589 cath|current|2ie4A00/9-589 cath|current|2nppA00/8-589 cath|current|2nppD00/8-589 cath|current|3k7vA00/9-589 cath|current|3k7wA00/9-589 9544.ENSMMUP00000028954 9598.ENSPTRP00000019597 9606.ENSP00000324804 ENSMMUP00000028954 ENSPTRP00000019597 gi|21361399|ref|NP_055040.2| ENSPANP00000010005 ENSP00000391905 2ie3_A 2ie4_A 2npp_A 2npp_D 3k7v_A 3k7w_A 2ie3A NP_001244851.1.72884 NP_001270063.1.63531 NP_055040.2.87134 NP_055040.2.92137 XP_002762479.1.60252 XP_003807682.1.60992 XP_003944261.1.74449 XP_004061383.1.27298 XP_007996048.1.81039 XP_010374830.1.97406 XP_011766092.1.29376 XP_011801595.1.43180 XP_011821247.1.47321 XP_011936550.1.92194 XP_016789826.1.37143 XP_017359406.1.71028 XP_017720210.1.44346 ENSCJAP00000003657 ENSMMUP00000028954 ENSP00000324804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]