SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000019870 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000019870
Domain Number 1 Region: 239-296
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.66e-24
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 2 Region: 407-464
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.84e-23
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 3 Region: 9-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-23
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 4 Region: 463-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.39e-23
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 5 Region: 351-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.06e-22
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 6 Region: 509-561
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.55e-20
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 7 Region: 295-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.79e-18
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 8 Region: 199-249
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000235
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000019870   Gene: ENSPTRG00000011546   Transcript: ENSPTRT00000021531
Sequence length 627
Comment pep:known chromosome:CHIMP2.1.4:19:62235592:62256794:1 gene:ENSPTRG00000011546 transcript:ENSPTRT00000021531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVLTDRAQVSVTFDDVAVTFTKEEWGQLDLAQRTLYQEVMLENCGLLVSLGCPVPKA
ELICHLEHGQEPWTRKEDLSQDTSPGDKGKPKTTEPTTCEPALSEGISLQGQVTQGNSVD
SQMGQAEDQDGLSEMQEGHFRPGIDPQEKSPGKMSPECDGLGTADGVCSRIGQEQVSPGD
TVHSHNSCESGKDPMIQEEENNFKCSECGKVFNKKHLLAGHEKIHSGVKPYECTECGKTF
IKSTHLLQHHMIHTGERPYECMECGKAFNRKSYLTQHQRIHSGEKPYKCNECGKAFTHRS
NFVLHNRRHTGEKSFVCTECGQVFRHRPGFLRHYVVHSGENPYECLECGKVFKHRSYLMW
HQQTHTGEKPYECSECGKVFLESAALIHHYVIHTGEKPFECLECGKAFNHRSYLKRHQRI
HTGEKPFVCSECGKAFTHCSTFILHKRAHTGEKPFECKECGKAFSNRKDLIRHFSIHTGE
KPYECVECGKAFTRMSGLTRHKRIHSGEKPYECVECGKSFCWSTNLIRHAIIHTGEKPYK
CSECGKAFSRSSSLTQHQRMHTGKNPISVTDVGRPFTSGQTSVTLRELLLGKDFLNVTTE
ANILPEETSSSASDQPYQRETPQVSSL
Download sequence
Identical sequences H2QH95
ENSPTRP00000019870 XP_003316748.1.37143 9598.ENSPTRP00000019870 ENSPTRP00000019870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]