SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000019874 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000019874
Domain Number 1 Region: 235-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-24
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 2 Region: 403-460
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.08e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 3 Region: 459-516
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.62e-24
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 4 Region: 347-404
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.11e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 4-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.19e-23
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 6 Region: 291-348
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.89e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 7 Region: 505-557
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-19
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 8 Region: 195-245
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.91e-16
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000019874   Gene: ENSPTRG00000011549   Transcript: ENSPTRT00000021535
Sequence length 600
Comment pep:known chromosome:CHIMP2.1.4:19:62362482:62372411:1 gene:ENSPTRG00000011549 transcript:ENSPTRT00000021535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASAQVSVTFQDVAVTFTQEEWGQLDAAQRTLYQEVMLETCGLLMSLGCPLFKPELIYQ
LDHRQELWMATKDLSQSSYPGDNTKPKTTEPTFFHLALPEEVLLQERLTQGASKNSQLGQ
SKDQDGPSEMQEVHLKIGIGPQRGKLLEKMSSEHDGLGSDDGVCTKITQKQVSTEGDLYE
CDSHGPVTDALIREEKNSYKCEECGKVFKKNSLLVQHERIHTQVKPYECTECGKTFSKST
HLLQHHIIHTGEKPYKCMECGKAFNRRSHLTRHQRIHTGEKPYKCSECGKAFTHRSTFVL
HHRSHTGEKPFVCKECGKAFRDRPGFIRHYIIHTGEKPYECIECGKAFNRRSYLTWHQQI
HTGVKPFECNECGKAFCESADLIQHYIIHTGEKPYKCMECGKAFNRRSHLKQHQRIHTGE
KPYECSECEKAFTHYSTFVLHKRTHTGEKPYECKECGKAFSDRADLIRHFSIHTGEKPYE
CVECGKAFNRSSHLTRHQQIHTGEKPYECIQCGKAFCRSANLIRHSIIHTGEKPYECSEC
GKAFNRGSSLTHHQRIHTGRNPTIVTDVGRPFMTAQTSVNIQELLLGKEFLNITTEENLW
Download sequence
Identical sequences A0A2J8JLP0
ENSPTRP00000019874 9598.ENSPTRP00000019874 ENSPTRP00000019874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]