SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000019935 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000019935
Domain Number 1 Region: 495-552
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.25e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 439-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.39e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 551-608
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.1e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 383-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.86e-24
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 5 Region: 608-664
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.35e-23
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 6 Region: 34-92
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.63e-22
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 7 Region: 327-384
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.56e-21
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 8 Region: 653-705
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.36e-16
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 9 Region: 281-328
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000112
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 112-170
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000745
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 11 Region: 223-270
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000028
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000019935
Domain Number - Region: 173-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00857
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000019935   Gene: ENSPTRG00000011593   Transcript: ENSPTRT00000021604
Sequence length 706
Comment pep:novel chromosome:CHIMP2.1.4:19:63488542:63495990:-1 gene:ENSPTRG00000011593 transcript:ENSPTRT00000021604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPSPQVLMGLPALLMGPAQHTSWPCGSAVPTLKSMVTFEDVAVYFSQEEWELLDAAQR
HLYHSVMLENLELVTSLGCWRGVEGEEAHPEQNVSVEVLQVRIPNADPSTKKANSCDMCG
PFLKDILHLAEHQGTQSEEKPYTCGACGRDFWLNANLHQHQKEHSGGKPFRWYKDRDALM
KSSKVHLSENPFTCREGGKVILGSCDLLQLQAVDSGQKPYSNLGQLPEVCTTQKLFECSN
CGKAFLKSSTLLNHLRTHSEEIPFTCPTGGNFLEEKSILGNKKFHTGETPHVCKECGKAF
SHSSKLRKHQKFHTEVKYYECIACGKTFNHKLTFVHHQRIHSGERPYECGECGKAFSNRS
HLIRHEKVHTGERPFECLKCGRAFSQSSNFLRHQKVHTQVRPYECSQCGKSFSRSSALIQ
HWRVHTGERPYECSECGRAFNNNSNLAQHQKVHTGERPFECSECGRDFSQSSHLLRHQKV
HTGERPFECSDCGKAFGNSSTLIQHQKVHTGQRPYECSECRKSFSRSSSLIQHWRIHTGE
KPYECSECGKAFAHSSTLIEHWRVHTKERPYECNECGKFFSQNSILIKHQKVHTGEKPYK
CSECGKFFSRKSSLICHWRVHTGERPYECSECGRAFSSNSHLVRHQRVHTQERPYECIQC
GKAFSERSTLVRHQKVHTRERTYECSQCGKLFSHLCNLAQHKKIHT
Download sequence
Identical sequences H2QHC1
XP_003316816.2.37143 ENSPTRP00000019935 9598.ENSPTRP00000019935 ENSPTRP00000019935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]