SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000020180 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000020180
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.29e-51
Family Calponin-homology domain, CH-domain 0.00000035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000020180   Gene: ENSPTRG00000011742   Transcript: ENSPTRT00000021875
Sequence length 156
Comment pep:known chromosome:CHIMP2.1.4:2A:27391694:27401230:1 gene:ENSPTRG00000011742 transcript:ENSPTRT00000021875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRK
VKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYD
GKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTA
Download sequence
Identical sequences ENSPTRP00000020180 9598.ENSPTRP00000020180 ENSPTRP00000020180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]