SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000020608 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000020608
Domain Number 1 Region: 157-250
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.34e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000020608   Gene: ENSPTRG00000011999   Transcript: ENSPTRT00000022331
Sequence length 252
Comment pep:known chromosome:CHIMP2.1.4:2A:69067448:69081927:1 gene:ENSPTRG00000011999 transcript:ENSPTRT00000022331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESEMEAQSAGAEEGFTQVTRKGGRRAKKRQAEQLSAAGEGGDAGRMDTEEARPAKRPVF
PPLCGDGLLSGKEETRKIPVPANRYTPLKENWMKIFTPIVEHLGLQIRFNLKSRNVEIRT
CKETKDVSALTKAADFVKAFILGFQVEDALALIRLDDLFLESFEITDVKPLKGDHLSRAI
GRIAGKGGKTKFTIENVTRTRIVLADVKVHILGSFQNIKMARTAICNLILGNPPSKVYGN
IRAVASRSADRF
Download sequence
Identical sequences A0A0D9RQP5 A0A2I3H5E8 A0A2K5KYL5 A0A2K5Z6A4 A0A2K6BQN6 F7HKB6 G3R194 H2QI04 I7GPI7
NP_001270946.1.63531 XP_003262524.1.23891 XP_007968603.1.81039 XP_011711757.1.29376 XP_011895038.1.92194 ENSPTRP00000020608 9544.ENSMMUP00000022985 9598.ENSPTRP00000020608 ENSNLEP00000012184 ENSMMUP00000022985 ENSMMUP00000022985 ENSGGOP00000008949 ENSNLEP00000012184 ENSGGOP00000008949 ENSPTRP00000020608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]