SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000022026 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000022026
Domain Number 1 Region: 689-981
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-80
Family Protein kinases, catalytic subunit 0.000000000484
Further Details:      
 
Domain Number 2 Region: 21-181
Classification Level Classification E-value
Superfamily L domain-like 2.13e-46
Family L domain 0.0000143
Further Details:      
 
Domain Number 3 Region: 299-491
Classification Level Classification E-value
Superfamily L domain-like 7.66e-45
Family L domain 0.00000197
Further Details:      
 
Domain Number 4 Region: 476-607
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.6e-22
Family Growth factor receptor domain 0.00000284
Further Details:      
 
Domain Number 5 Region: 160-305
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.14e-18
Family Growth factor receptor domain 0.000000477
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000022026   Gene: ENSPTRG00000012883   Transcript: ENSPTRT00000023888
Sequence length 1282
Comment pep:known chromosome:CHIMP2.1.4:2B:216310891:217071989:-1 gene:ENSPTRG00000012883 transcript:ENSPTRT00000023888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVCAGTENKLSSLSDLEQQYRALRKYYENCEVVMGNLEITSIEHNRDLSFLRSVREVTGY
VLVALNQFRYLPLENLRIIRGTKLYEDRYALAIFLNYRKDGNFGLQELGLKNLTEILNGG
VYVDQNKFLCYADTIHWQDIVRNPWPSNLTLVSTNGSSGCGRCHKSCTGRCWGPTENHCQ
TLTRTVCAEQCDGRCYGPYVSDCCHRECAGGCSGPKDTDCFACMNFNDSGACVTQCPQTF
VYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVDSSSCVRACPSSKMEVEENGIKMCKPC
TDICPKACDGIGTGSLMSAQTVDSSNIDKFINCTKINGNLIFLVTGIHGDPYNAIEAIDP
EKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNLVTIGGRVLYSGLSLLILKQQGITSLQ
FQSLKEISAGNIYITDNSNLCYYHTINWTTLFSTINQRIVIRDNRKAENCTAEGMVCNHL
CSSDGCWGPGPDQCLLCRRFSRGRICIESCNLYDGEFREFENGSICVECDPQCEKMEDGL
LTCHGPGPDNCTKCSHFKDGPNCVEKCPDGLQGANSFIFKYADPDRECHPCHPNCTQGCN
GPTSHDCIYYPWTGHSTLPQHARTPLIAAGVIGGLFILVIVGLTFAVYVRRKSIKKKRAL
RRFLETELVEPLTPSGTAPNQAQLRILKETELKRVKVLGSGAFGTVYKGIWVPEGETVKI
PVAIKILNETTGPKANVEFMDEALIMASMDHPHLVRLLGVCLSPTIQLVTQLMPHGCLLE
YVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLAR
LLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPT
REIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLV
IQGDDRMKLPSPNDSKFFQNLLDEEDLEDMMDAEEYLVPQAFNIPPPIYTSRARIDSNRS
EIGHSPPPAYTPMSGNQFVYRDGGFAAEQGVSVPYRAPTSTIPEAPVAQGATAEIFDDSC
CNGTLRKPVAPHVQEDSSTQRYSADPTVFAPERSPRGELDEEGYMTPMRDKPKQEYLNPV
EENPFVSRRKNGDLQALDNPEYHNASNGPPKAEDEYVNEPLYLNTFANTLGKAEYLKNNI
LSMPEKAKKAFDNPDYWNHSLPPRSTLQHPDYLQEYSTKYFYKQNGRIRPIVAENPEYLS
EFSLKPGTVLPPPPYRHRNTVV
Download sequence
Identical sequences ENSPTRP00000022026 ENSPTRP00000022026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]