SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000022629 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000022629
Domain Number 1 Region: 6-83
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000288
Family Calponin-homology domain, CH-domain 0.0051
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000022629
Domain Number - Region: 197-232
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 0.0288
Family Trimerization domain of TRAF 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000022629   Gene: ENSPTRG00000013205   Transcript: ENSPTRT00000024533
Sequence length 236
Comment pep:known chromosome:CHIMP2.1.4:20:3647504:3651837:-1 gene:ENSPTRG00000013205 transcript:ENSPTRT00000024533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSVDEEALHQLYLWVDNIPLSRPKRNLSRDFSDGVLVAEVIKFYFPKMVEMHNYVPAN
SLQQKLSNWGHLNRKVLKRLNFSVPDDVMRKIAQCSPGVVELVLIPLRQRLEERQRRRKQ
GAGSLQELAPQDGSGYMDVGVSQKARGEGVPDPQGGGQLSWDRPPAPRPPAYNRALQGDP
SFVLQIAEKEQELLASQETVQVLQMKVRRLEHLLQLKNVRIEDLSRRLQQAERKQR
Download sequence
Identical sequences ENSPTRP00000022629 XP_003821360.1.60992 ENSPTRP00000022629 9598.ENSPTRP00000022629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]