SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000022692 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000022692
Domain Number 1 Region: 50-324
Classification Level Classification E-value
Superfamily L domain-like 3.15e-43
Family Ngr ectodomain-like 0.018
Further Details:      
 
Domain Number 2 Region: 578-664
Classification Level Classification E-value
Superfamily Fibronectin type III 5.13e-17
Family Fibronectin type III 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000022692   Gene: ENSPTRG00000013235   Transcript: ENSPTRT00000024596
Sequence length 740
Comment pep:known chromosome:CHIMP2.1.4:20:5907536:5921493:-1 gene:ENSPTRG00000013235 transcript:ENSPTRT00000024596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQTLPLLLLTVLRPSWADPPQEKVPLFRVTQQGPWGSSGSNATDSPCEGLPAADATALS
LANRNLERLPGCLPRTLRSLDASHNLLRALSTSELGHLEQLQVLTLRHNRIAALRWGPGG
PAGLHTLDLSYNQLAALPPCAGPALSSLRALALAGNPLRALQPRAFACFPALQLLNLSCT
ALGRGAQGGIAEAAFAGEDGAPLVTLEVLDLSGTFLERVESGWIRDLPKLTSLYLRKMPR
LTTLEGDIFKMTPNLQQLDCQDSPALASVATHIFQDTPHLQVLLFQNCNLSSFPPWTLDS
SQVLSINLFGNPLTCSCDLSWLLTDAKRTVLSRAADTMCAPAAGSSGPFSASLSLSQLPG
VCQSDQSTTLRASHPPCFNRSTYAQGPTVAPSAAPATRPAGDQQSVSKAPNVGSRTVAAW
PHSDAREGTAPSTTNSVAGHSNSSVFPRAASTTRTQHRGEHAPGLVLEPDISAASTPLAS
KLLGPFPTSWDRSISSPQPGQRTHATPQASNPSPSEGEIPVLLLDDYSEEEEGRKEEVGT
PHQDVPCDYHPCKHLQTPCAELQRRWRCRCPGLSGEDTIPDPPRLQGVTETTDTSALVHW
CAPNSVVHGYQIRYSAEGWAGNQSVVGVIYATARQHPLYGLSPGTTYRVCVLAANRAGLS
QPRSSGWRSPCAAFTTKPSFALLLSGLCAASGLLLASTMVLSACLCRRGRMLRLQRCDTH
LVAYKNPAFDDYPLGLQTVS
Download sequence
Identical sequences H2QJY0
XP_001167419.1.37143 ENSPTRP00000022692 ENSPTRP00000022692 9598.ENSPTRP00000022692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]