SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000023636 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000023636
Domain Number 1 Region: 99-172
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 9.81e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000023636   Gene: ENSPTRG00000013728   Transcript: ENSPTRT00000025606
Sequence length 225
Comment pep:known chromosome:CHIMP2.1.4:20:60386071:60386748:-1 gene:ENSPTRG00000013728 transcript:ENSPTRT00000025606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELKSLSGDAYLALSHGYAAAAAGLAYGAAREPEAARGYGTPGPGGDLPAAPAPRAPAQ
AAESSGEQSGDEDDAFEQRRRRRGPGSAADGRRRPREQRSLRLSINARERRRMHDLNDAL
DGLRAVIPYAHSPSVRKLSKIATLLLAKNYILMQAQALDEMRRLVAFLNQGQGLAAPVNA
APLTPFGQATVCPFSAGAALGPCPDKCAAFSGTPSALCKHCHEKP
Download sequence
Identical sequences A0A2J8KN03 Q8NDY6
ENSP00000359371 ENSP00000359371 ENSPTRP00000023636 9598.ENSPTRP00000023636 9606.ENSP00000359371 gi|57529222|ref|NP_542173.1| ENSP00000359371 ENSPTRP00000023636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]