SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000023715 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000023715
Domain Number 1 Region: 80-130
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000146
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 2 Region: 491-535
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000111
Family Classic zinc finger, C2H2 0.0024
Further Details:      
 
Domain Number 3 Region: 721-776
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000139
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 539-566
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000316
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 629-657
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000104
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 6 Region: 784-808
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000283
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Domain Number 7 Region: 583-619
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000043
Family Classic zinc finger, C2H2 0.058
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000023715
Domain Number - Region: 138-169
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00563
Family Classic zinc finger, C2H2 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000023715   Gene: ENSPTRG00000013766   Transcript: ENSPTRT00000025687
Sequence length 892
Comment pep:known chromosome:CHIMP2.1.4:20:61365498:61449575:-1 gene:ENSPTRG00000013766 transcript:ENSPTRT00000025687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDPFCVGGRRLPGSSKSGPGKDGSRKEVRLPMLHDPPKMGMPVVRGGQTVPGQAPLCFD
PGSPTSDKTEGKKKGRPKAENQALRDIPLSLMNDWKDEFKAHSRVKCPNSGCWLEFPSIY
GLKYHYQRCQGGAISDRLAFPCPFCEAAFTSKTQLEKHRIWNHMDRPLPASKPGPISRPV
TISRPVGVSKPIGVSKPVTIGKPVGVSKPIGISKPVSVGRPMPVNKAIPVTRPMPVTKPV
TVSRPMPVTKAMPVTKPITVTKSVPVTKPVPVTKPITVTKLVTVTKPVPVTKPVTVSRPI
VVSKPVTVSRPIAISRHTPPCKMVLLTRSENKAPRATGRNSGKKRAADSLDTCPIPPKQA
RPENGEYGPSSMGQSSAFQLSADTSSGSLSPGSRPSGGMEALKAAGPASPPEEDPERTKH
RRKQKTPKKFTGEQPSISGTFGLKGLVKAEDKARVHRSKKQEVPGPEDARKKVPAAPITV
SKEAPAPVAHPAPGGPEEQWQRAIHERGEAVCPTCNVVTRKTLVGLKKHMEVCQKLQDAL
KCQHCRKQFKSKAGLNYHTMAEHSAKPSDAEASEGGEQEERERLRKVLKQMGRLRCPQEG
CGAAFSSLMGYQYHQRRCGKPPCEVDSPSFPCTHCGKTYRSKAGHDYHVRSEHTAPPPEE
PTDKSPEAEDPLGVERTPSGRVRRTSAQVAVFHLQEIAEDELARDWTKRRMKDDLVPETA
RLNYTRPGLPTLNPQLLEAWKNEVKEKGHVNCPNDCCEAIYSSVSGLKAHLASCSKGAHL
AGKYRCLLCPKEFSSESGVKYHILKTHAENWFRTSADPPPKHRSQDSLVPKKEKKKNLAG
GKKRGRKPKERTPEEPVAKLPPRRDDWPPGCRDKGARGSTGRKVGVSKAPEK
Download sequence
Identical sequences H2QKT7
XP_016793876.1.37143 ENSPTRP00000023715 9598.ENSPTRP00000023715 ENSPTRP00000023715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]