SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000023992 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000023992
Domain Number 1 Region: 287-533
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.42e-89
Family Eukaryotic proteases 0.0000442
Further Details:      
 
Domain Number 2 Region: 188-294
Classification Level Classification E-value
Superfamily SRCR-like 7.06e-19
Family Hepsin, N-terminal domain 0.04
Further Details:      
 
Domain Number 3 Region: 154-192
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000681
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000023992   Gene: ENSPTRG00000013942   Transcript: ENSPTRT00000026005
Sequence length 538
Comment pep:known chromosome:CHIMP2.1.4:21:28425595:28450681:-1 gene:ENSPTRG00000013942 transcript:ENSPTRT00000026005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVVGPKPLPTLLCGGRTGHRTAWVLSFLIRSCPCEPGKGCVYGKPVILWPTISSVVPST
FLGLGNYEAEVEAEPDVRGPETVTMGENDPPAAEAPFSFRSLFGLDDLKISPVAPDADAV
AAQILSLLPLKFFPIIVIGIIALILALAIGLGIHFDCSGKYRCRSSFKCIELTARCDGVS
DCKDGEDEYRCVRVSGQNAVLQVFTAASWKTMCSDDWKGHYANVACAQLGFPSYVSSDNL
RVSSLEGQFREEFVSIDHLLPDDKVTALHHSVYVREGCASGHVVTLQCTACGHRRGYSSR
IVGGNMSLLSQWPWQASLQFQGYHLCGGSVITPLWIVTAAHCVYDLYLPKSWTIQVGLVS
LLDNPAPSHLVEKIVYHSKYKPKRLGNDIALMKLAGPLTFNEMIQPVCLPNSEENFPDGK
VCWTSGWGATEDGAGDASPVLNHAAVPLISNKICNHRDVYGGIISPSMLCAGYLKGGVDS
CQGDSGGPLVCQERRLWKLVGATSFGIGCAEVNKPGVYTRVTSFLDWIHEQMERDLKT
Download sequence
Identical sequences ENSPTRP00000023992 9598.ENSPTRP00000023992 ENSPTRP00000023992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]