SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000027971 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000027971
Domain Number 1 Region: 1100-1228
Classification Level Classification E-value
Superfamily TNF-like 1.78e-25
Family TNF-like 0.0015
Further Details:      
 
Domain Number 2 Region: 1042-1081
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000419
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000027971   Gene: ENSPTRG00000016284   Transcript: ENSPTRT00000030302
Sequence length 1229
Comment pep:known chromosome:CHIMP2.1.4:4:92183939:92250044:1 gene:ENSPTRG00000016284 transcript:ENSPTRT00000030302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAARLFVLLSSLWSGGIGLNNSKHSWTIPEDGNSQKTMPSASVPPNKIQSLQILPTTQD
MSAEIATTPEARTSEDSLLKSTLPPSETSAPAEGVRNQTLTSTEKAEGVVKLQNLTLPTN
ASIKFNPGAESVVLSNSTLKFLQSFARKSNEQATSLNTVGGTGGIGGIGGTGGVGNRAPR
ETYLSRGDSSSSQRTDYQKSNFETTRGKNWCAYVHTRLSPTVILDNQVTYVPGGRGPCGW
TGGSCPQRSQKISNPVYRMQHKIVTSLDWRCCPGYSGPKCQLRAQEQQSLIHTNQAESHT
AVGRGVAEQQQQQQGCGDPEVMQKMTDQVNYQAMKLTLLQKKIDNISLTVNDVRNTYSSL
EGKVSEDKSREFQSLLKGLKSKSINVLIRDIVREQFKIFQNDMQETVAQIFKTVSSLSED
LESTRQIIQKVNESVVSIAAQQKFVLVQETRPTLTDIVELRNHIVNVRQEMTLTCEKPIK
KLEVKQTHLEGALEQEHSRSILYYESLNKTLSKLKEVHEQLLSTEQVSDQKNVPAAESVS
NNVTEYISTLHENIKKQSLMMLQMFEDLHIQESKINNLTISLEMEKESLRGECEDMLSKC
RNDFKFQLKDTEENLHVLNQTLAEVLFPMDNKMDKMSEQLNDLTYDMEILQPLLEQGASL
RQTMTYEQPKEAIVIRKKIENLTSAVNSLNLIIKELTKRHNLLRNEVQGRDDALERRINE
YALEMEDGLNKTMTIINNAIDFIQDNYALKETLSTIKDNSEIHHKCTSDMETILTFIPQF
QRLNDSIQSLVNDNQRYNFVLQVAKTLAGIPRDEKLNQSNFQKMYQMFNETTSQVRKYQQ
NMSHLEEKLLLTTKISKNFETRLQDIESKVTQTLIPYYISVKKGSVVTNERDQALQLQVL
NSRFKALEAKSIHLSINFFSLNKTLHEVLTMCHNASTSVSELNATIPKWIKHSLTDIQLL
QKGLTEFVEPIIQIKTQAVLSNLTCCIDRSLPGSLANVVKSQKQLKSLPKKISALKKPTV
NLTTVLIGRTQRNTDNIIYPEEYSSCSRHPCQNGGTCINGRTSFTCACRHPFTGDNCTIK
LVEENALAPDFSKGSYRYAPMVAFFASHTYGMTTPGPILFNNLDVNYGASYTPRTGKFRI
PYLGIYVFKYTIESFSAHISGFLVVDGIDKLAFESENINSEIHCDRVLTGDALLELNYGQ
EVWLRLAKGTIPAKFPPVTTFSGYLLYRT
Download sequence
Identical sequences 9598.ENSPTRP00000027971 ENSPTRP00000027971 ENSPTRP00000027971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]