SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000028804 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000028804
Domain Number 1 Region: 157-395
Classification Level Classification E-value
Superfamily RNI-like 2.35e-42
Family Cyclin A/CDK2-associated p19, Skp2 0.000000000675
Further Details:      
 
Domain Number 2 Region: 89-143
Classification Level Classification E-value
Superfamily F-box domain 3.53e-16
Family F-box domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000028804   Gene: ENSPTRG00000016797   Transcript: ENSPTRT00000031184
Sequence length 424
Comment pep:known chromosome:CHIMP2.1.4:5:78973461:79003365:-1 gene:ENSPTRG00000016797 transcript:ENSPTRT00000031184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLG
HPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKV
SGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSP
FRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGC
SGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKS
DLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIP
TLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQK
PSCL
Download sequence
Identical sequences A0A024R069 A0A2I3RFB4 Q13309
9606.ENSP00000274255 ENSP00000274255 gi|16306595|ref|NP_005974.2| ENSPTRP00000028804 NP_005974.2.87134 NP_005974.2.92137 XP_003806703.1.60992 XP_526948.2.37143 ENSP00000274255 ENSPTRP00000028804 ENSP00000274255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]