SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000031600 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000031600
Domain Number - Region: 81-227
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 0.000392
Family Brix domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000031600   Gene: ENSPTRG00000018503   Transcript: ENSPTRT00000034191
Sequence length 306
Comment pep:known chromosome:CHIMP2.1.4:6:112060154:112104889:1 gene:ENSPTRG00000018503 transcript:ENSPTRT00000034191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTLDRVVKPKTKRAKRFLEKREPKLNENIKNAMLIKGGNANATVTKVLKDVYALKKPYG
VLYKKKNITRPFEDQTSLEFFSKKSDCSLFMFGSHNKKRPNNLVIGRMYDYHVLDMIELG
IENFVSLKDIKNSKCPEGTKPMLIFAGDDFDVTEDYRRLKSLLIDFFRGPTVSNIRLAGL
EYVLHFTALNGKIYFRSYKLLLKKSGCRTPRIELEEMGPSLDLVLRRTHLASDDLYKLSM
KMPKALKPKKKKNISHDTFGTTYGRIHMQKQDLSKLQTRKMKGLKKRPAERITEDHEKKS
KRIKKN
Download sequence
Identical sequences A0A2I3RSJ1 Q9H7B2
GO.34769 ENSP00000402338 ENSP00000357857 gi|39930469|ref|NP_115570.1| 9598.ENSPTRP00000031600 9606.ENSP00000402338 NP_115570.1.87134 NP_115570.1.92137 XP_001156493.1.37143 XP_003822251.1.60992 ENSP00000402338 ENSPTRP00000031600 Hs20551627___KOG3031 ENSPTRP00000031600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]