SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000032682 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000032682
Domain Number 1 Region: 1-144
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.9e-42
Family Cofilin-like 0.0027
Further Details:      
 
Domain Number 2 Region: 382-438
Classification Level Classification E-value
Superfamily SH3-domain 2.1e-18
Family SH3-domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000032682   Gene: ENSPTRG00000019134   Transcript: ENSPTRT00000035352
Sequence length 439
Comment pep:known chromosome:CHIMP2.1.4:7:42705519:42722590:1 gene:ENSPTRG00000019134 transcript:ENSPTRT00000035352 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAANLSRNGPALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGTGEGGLEEMVEELNSG
KVMYAFCRVKDPNSGLPKFVLINWTGEGVNDVRKGACASHVSTMANFLKGAHVTINARAE
EDVEPECIMEKVAKASGANYSFHKESGRFQDAGPQAPVGSVYQKTNAVSEIKRVGKDSFW
AKAEKEEENRRLEEKRRAEEAQRQLEQERRERELREAARREQRYQEQGGEASPQSRTWEQ
QQEVVSRNRNEQGSTCASLQESAVHPREIFKQKERAMSTTSISSPQPGKLRSPFLQKQLT
QPETHFGREPAAAISRPRADLPAEEPAPSTPPCLVQAEEEAVYEEPPEQETFYEQPPLVQ
QQGAGSEHIDHHIQGQGLSGQGLCARALYDYQAADDTEISFDPENLITGIEVIDEGWWRG
YGPDGHFGMFPANYVELIE
Download sequence
Identical sequences H2QUH8
ENSPTRP00000032682 ENSPTRP00000032682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]