SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000033031 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000033031
Domain Number 1 Region: 16-203
Classification Level Classification E-value
Superfamily Rhomboid-like 1.96e-21
Family Rhomboid-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000033031   Gene: ENSPTRG00000019312   Transcript: ENSPTRT00000035734
Sequence length 364
Comment pep:known chromosome:CHIMP2.1.4:7:75945009:75954972:1 gene:ENSPTRG00000019312 transcript:ENSPTRT00000035734 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASGPGCRSWCLCPEVPSATFFTALLSLLVSGPRLFLLQQPLAPSGLTLKSEALRNWQV
YRLVTYIFVYENPISLLCGAIIIWRFAGNFERTVGTVRHCFFTVIFAIFSAIIFLSFEAV
SSLSKLGEVEDARGFTPVAFAMLGVTTVRSRMRRALVFGMVVPSVLVPWLLLGASWLIPQ
TSFLSNVCGLSIGLAYGLTYCYSIDLSERVALKLDQTFPFSLMRRISVFKYVSGSSAERR
AAQSRKLNPVPGSYPTQSCHPHLSPSHPVSQTQHASGQKLASWPSCTPGHMPTLPPYQPA
SGLCYVQNHFGPNPTSSSVYPASAGTSLGIQPPTPVNSPGTVYSGALGTPGAAGSKESSR
VPMP
Download sequence
Identical sequences H2QUS6 Q6NTF9
ENSP00000006777 ENSP00000458798 NP_001035546.1.87134 NP_001035546.1.92137 XP_003808971.1.60992 XP_519156.1.37143 ENSPTRP00000033031 gi|94818790|ref|NP_001035546.1| ENSP00000006777 ENSPTRP00000033031 ENSP00000006777 ENSP00000458945 9598.ENSPTRP00000033031 9606.ENSP00000006777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]