SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000033054 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000033054
Domain Number 1 Region: 107-183
Classification Level Classification E-value
Superfamily WWE domain 9.81e-24
Family WWE domain 0.00097
Further Details:      
 
Domain Number 2 Region: 18-109
Classification Level Classification E-value
Superfamily WWE domain 1.26e-23
Family WWE domain 0.0013
Further Details:      
 
Domain Number 3 Region: 393-494
Classification Level Classification E-value
Superfamily RING/U-box 1.64e-19
Family RING finger domain, C3HC4 0.0000036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000033054   Gene: ENSPTRG00000019326   Transcript: ENSPTRT00000035762
Sequence length 622
Comment pep:known chromosome:CHIMP2.1.4:7:76533173:76578433:1 gene:ENSPTRG00000019326 transcript:ENSPTRT00000035762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMAPSPSLVQVYTSPVAVAVWEWQDGLGTWHPYSATVCSFIEQQFVQQKGQRFGLGSLA
HSIPLGQADPSLAPYIIDLPSWTQFRQDTGTMRAVRRHLFPQHSAPGRGVVWEWLSDDGS
WTAYEASVCDYLEQQVARGNQLVDLAPLGYNYTVNYTTHTQTNKTSSFCRSVRRQAGPPY
PVTTIIAPPGHTGVACSCHQCLSGSRTGPVSGRYRHSMTNLPAYPAPQHPPHRTASVFGT
HQAFAPYNKPSLSGARSAPRLNTTNPWGAAPPSLGSQPVYRSSLSHLGPQHLPPGSSTSG
AVSASLPSGPSSSPGSVPATVPVQMPKPSRVQQALAGMTSVLMSAIGLPVCLSRAPQPTS
PPASRLASKSHGSVKRLRKMSVKGATPKPEPEPEQVIKNYTEELKVPPDEDCIICMEKLS
AASGYSDVTDSKAIGPLAVGRLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKTIYGEKT
GTQPQGKMEVLRFQMSLPGHEDCGTILIVYSIPHGIQGPEHPNPGKPFTARGFPRQCYLP
DNAQGRKVLELLKVAWKRRLIFTVGTSSTTGETDTVVWNEIHHKTEMDRNVTGHGYPDPN
YLQNVLAELAAQGVTEDCLEQQ
Download sequence
Identical sequences K7D3B9
ENSPTRP00000033054 ENSPTRP00000033054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]