SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000033167 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000033167
Domain Number 1 Region: 113-406
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.47e-89
Family Protein kinases, catalytic subunit 0.000000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000033167   Gene: ENSPTRG00000019387   Transcript: ENSPTRT00000035878
Sequence length 451
Comment pep:known chromosome:CHIMP2.1.4:7:91249146:91744768:1 gene:ENSPTRG00000019387 transcript:ENSPTRT00000035878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHGYFGCNAAAEPGYSAFVGTPQICVTKMSTRNCQGMDSVIKPLDTIPEDKKVRVQRTQS
TFDPFEKPANQVKRVHSENNACINFKTSSTGKESPKVRRHSSPSSPTSPKFGKADSYEKL
EKLGEGSYATVYKGKSKVNGKLVALKVIRLQEEEGTPFTAIREASLLKGLKHANIVLLHD
IIHTKETLTLVFEYVHTDLCQYMDKHPGGLHPDNVKLFLFQLLRGLSYIHQRYILHRDLK
PQNLLISDTGELKLADFGLARAKSVPSHTYSNEVVTLWYRPPDVLLGSTEYSTCLDMWGV
GCIFVEMIQGVAAFPGMKDIQDQLERIFLVLGTPNEDTWPGVHSLPHFKPERFTLYSSKS
LRQAWNKLSYVNHAEDLASKLLQCSPKNRLSAQAALSHEYFSDLPPRLWELTDMSSIFTV
PNVRLQPEAGESMRAFGKNNSYDKSLSNSKH
Download sequence
Identical sequences A0A2I3RH19
ENSPTRP00000033167 ENSPTRP00000033167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]