SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000035227 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000035227
Domain Number 1 Region: 122-222
Classification Level Classification E-value
Superfamily SH2 domain 3.23e-31
Family SH2 domain 0.0000764
Further Details:      
 
Domain Number 2 Region: 67-118
Classification Level Classification E-value
Superfamily SH3-domain 0.00000179
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000035227   Gene: ENSPTRG00000020601   Transcript: ENSPTRT00000038101
Sequence length 316
Comment pep:known chromosome:CHIMP2.1.4:8:131730856:131754490:-1 gene:ENSPTRG00000020601 transcript:ENSPTRT00000038101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSKLGHSPLGGLRARLTFPVCLLYHRLWASSAAPGKKKEMGNSMKSTPAPAERPLPNPE
GLDSDFLAVLSDYPSPDISPPIFRRGEKLRVISDEGGWWKAISLSTGRESYIPGICVARV
YHGWLFEGLGRDKAEELLQLPDTKVGSFMIRESETKKGFYSLSVRHRQVKHYRIFRLPNN
WYYISPRLTFQCLEDLVNHYSEVADGLCCVLTTPCLTQSTAAPAVRASSSPVTLRQKTVD
WRRVSRLQEDPEGTENPLGVDESLFSYGLRESIASYLSLTSEDNTSFDRKKKSISLMYGG
SKRKSSFFSSPPYFED
Download sequence
Identical sequences A0A2I3RDT6
ENSPTRP00000035227 XP_016815377.1.37143 ENSPTRP00000035227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]