SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000035479 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000035479
Domain Number 1 Region: 580-632
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000255
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 2 Region: 533-564
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000212
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 3 Region: 624-651
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000445
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 4 Region: 500-530
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000596
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000035479   Gene: ENSPTRG00000020738   Transcript: ENSPTRT00000038379
Sequence length 929
Comment pep:known chromosome:CHIMP2.1.4:9:3841321:4331873:-1 gene:ENSPTRG00000020738 transcript:ENSPTRT00000038379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGRSCSMSLHRTSGTPQGPRMVSGHHIPAIRAHSGTPGPSPCGSTSSPTMGSLANNLHL
KMPSGGGMAPQNNVAESRIHLPALSPRRQMLTNGKPRFQVTQAGGMSGSHTLKPKQQEFG
SPFPPNPGKGALGFGPQCKSIGKGSCNNLVVTSSPMMVQRLGLISPPASQVSTACNQISP
SLQRAMNAANLNIPPSDTRSLISRESLASTTLSLTESQSASSMKQEWSQGYRALPSLSNH
GSQNGLDLGDLLGLPPGTSMSSSSVSNSLPSYLFGMESSHSPYPSPRHSSTRSHSARSKK
RALSLSPLSDGIGIDFNTIIRTSPTSLVAYINGSRASPANMSPQPEVYGHFLGVRGSCIP
QPCPVPSSQKGVLVAPGGLALPAYGEDGALEYERMQQLEHGGLQPGLVNNMVVQHGLPGP
DSQPAGLFKTERLEEFPGSTGDLPPAPPLPPLPPPQGPPPPYHAHAHLHHPELGPHAQQL
ALPQATLDDDGEMDGLGGKHCCRWIDCSALYDQQEELVRHIEKVHIDQRKGEDFTCFWAG
CPRRYKPFNARYKLLIHMRVHSGEKPNKCTVSFRSARVRLENMKIHLRSHTGEKPYLCQH
PGCQKAFSNSSDRAKHQRTHLDTKPYACQIPGCTKRYTDPSSLRKHVKAHSSKEQQARKK
LRSSTELHPDLLTDCLTVQPLQPATSPRDAAAEGTVGRSPGPGPDLYSAPIFSSNYSSRS
GTAAGAVPPPHPVSHPSPGHNVQGSPHNPSSQLPPLTAVDAGAERFAPSAPSPHHISPRR
VPAPSSILQRTQPPYTQQPSGSHLKSYQPETNSSFQPNGIHVHGFYGQLQKFCPPHYPDS
QRIVPPVSSCSVVPSFEDCLVPTSMGQAGFDVFHRAFSTHSGITVYDLPSSSSSLFGESL
RSGAEDAAFLQISTVDRCPSQLSSVYTEG
Download sequence
Identical sequences ENSPTRP00000035479 ENSPTRP00000035479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]