SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000036781 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000036781
Domain Number 1 Region: 353-411
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000233
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 2 Region: 287-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000266
Family Laminin-type module 0.081
Further Details:      
 
Domain Number 3 Region: 409-453
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000536
Family Laminin-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000036781
Domain Number - Region: 24-65,104-166
Classification Level Classification E-value
Superfamily Sialidases 0.000196
Family Sialidases (neuraminidases) 0.076
Further Details:      
 
Domain Number - Region: 451-480
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000396
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000036781   Gene: ENSPTRG00000021493   Transcript: ENSPTRT00000039808
Sequence length 520
Comment pep:known chromosome:CHIMP2.1.4:9:131601450:131684714:1 gene:ENSPTRG00000021493 transcript:ENSPTRT00000039808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHLLALFLHCLPLASGDYDICKSWVTTDEGPTWEFYACQPKVMRLKDYVKVKVEPSGIT
CGDPPERFCSHENPYLCSNECDASNPDLAHPPRLMFDKEEEGLATYWQSITWSRYPSPLE
ANITLSWNKTVELTDDVVMTFEYGRPTVMVLEKSLDNGRTWQPYQFYAEDCMEAFGMSAR
RARDMSSSSAHRVLCTEEYSRWAGSKKEKHVRFEVRDRFAIFAGPDLRNMDNLYTRLESA
KGLKEFFTLTDLRMRLLRPALGGTYVQRENLYKYFYAISNIEVIGRCKCNLHANLCSMRE
GSLQCECEHNTTGPDCGKCKKNFRTRSWRAGSYLPLPHGSPNACAAAGSFGNCECYGHSN
RCSYIDFLNVVTCVSCKHNTRGQHCQHCRLGYYRNGSAELDDENVCIECNCNQIGSVHDR
CNETGFCECREGAAGPKCDDCLPTHYWRQGCYCQNGGTCLQNQRCACPRGYTGVRCEQPR
CDPADDDGGLDCDRAPGAAPRPATLLGCLLLLGLAARLGR
Download sequence
Identical sequences ENSPTRP00000036781 ENSPTRP00000036781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]