SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000040250 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000040250
Domain Number 1 Region: 105-182
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.49e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000040250   Gene: ENSPTRG00000020339   Transcript: ENSPTRT00000048370
Sequence length 206
Comment pep:known chromosome:CHIMP2.1.4:8:69747514:69751201:-1 gene:ENSPTRG00000020339 transcript:ENSPTRT00000048370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTGSVSDPEEMELRGLQREYPVPASKRPPLRGVERSYASPSDNSSAEEEDPDGEEERCA
LGTAGSAEGCKRKRPRVAGGGGAGGSAGGGGKKPLPAKGSAAECKQSQRNAANARERARM
RVLSKAFSRLKTSLPWVPPDTKLSKLDTLRLASSYIAHLRQLLQEDRYENGYVHPVNLTW
PFVVSGRPDSDTKEVSAANRLCGTTA
Download sequence
Identical sequences K7A6B3 O60682
ENSP00000321445 gi|116805332|ref|NP_005089.2| 9598.ENSPTRP00000040250 9606.ENSP00000321445 ENSP00000321445 ENSGGOP00000009716 HR4485 ENSGGOP00000009716 ENSP00000321445 NP_005089.2.87134 NP_005089.2.92137 XP_003831377.1.60992 XP_004047190.1.27298 XP_016815055.1.37143 ENSPTRP00000040250 ENSPTRP00000040250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]