SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000043137 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000043137
Domain Number 1 Region: 4-134
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.61e-43
Family Galectin (animal S-lectin) 0.000000254
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000043137   Gene: ENSPTRG00000010938   Transcript: ENSPTRT00000050481
Sequence length 136
Comment pep:novel chromosome:CHIMP2.1.4:19:43996480:43999025:1 gene:ENSPTRG00000010938 transcript:ENSPTRT00000050481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSGVALHFNPWLDTSEV
VFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVR
LVEVGGDVQLDSVRIF
Download sequence
Identical sequences ENSPTRP00000043137 ENSPTRP00000043137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]