SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000043424 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000043424
Domain Number 1 Region: 7-138
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.31e-40
Family Galectin (animal S-lectin) 0.0000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000043424   Gene: ENSPTRG00000041582   Transcript: ENSPTRT00000047974
Sequence length 142
Comment pep:known chromosome:CHIMP2.1.4:19:44794315:44799059:-1 gene:ENSPTRG00000041582 transcript:ENSPTRT00000047974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFLTVPYKLPVSLSVGSCVIIKGTPIDSSINEPQLQVDFYTEMNEDSEIAFHLRVHLGR
RVVMNSREFGIWMLEENLHYVPFEDGKPFDLRIYVCHNEYEVKVNGEYIYAFVHRIPPSY
VKMIQVWRDVSLDSVLVNNGRR
Download sequence
Identical sequences C4XV99 C4XVA2
XP_002829258.1.23681 XP_003812277.1.60992 ENSPTRP00000043424 ENSPTRP00000043424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]