SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000045565 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000045565
Domain Number 1 Region: 168-359,458-606
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 9.95e-92
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000846
Further Details:      
 
Domain Number 2 Region: 337-463
Classification Level Classification E-value
Superfamily GAD domain-like 1.6e-29
Family GAD domain 0.0015
Further Details:      
 
Domain Number 3 Region: 50-152
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.69e-23
Family Anticodon-binding domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000045565   Gene: ENSPTRG00000001698   Transcript: ENSPTRT00000048817
Sequence length 645
Comment pep:known chromosome:CHIMP2.1.4:1:152305238:152339409:1 gene:ENSPTRG00000001698 transcript:ENSPTRT00000048817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYFPSWLSQLYRGLSRPIRRTTQPIWGSVYRSLLQSSQRRIPEFSSFVVRTNTCGELRSS
HLGQEVTLCGWIQYRRQNTFLVLRDFDGLVQVIIPQDESAASVKKILCEAPVESVVQVSG
TVISRPAGQENPKMPTGEIEIKVKTAELLNACKKLPFEIKDFVKKTEALRLQYRYLDLRS
FQMQYNLRLRSQMVMKMREYLCNLHGFVDIETPTLFKRTPGGAKEFLVPSREPGKFYSLP
QSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGIQSLIEGL
LQYSWPNDKDPVVVPFPTMTFAEALATYGTDKPDTRFGMKIIDISDVFRNTEIGFLQDAL
SKPHGTVKAICIPEGAKYLKRKDIESIRKFAADHFNQEILPVFLNANRNWNSPVANFIME
SQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECADLLETRGVVLRDPTLFSFLW
VVDFPLFLPKEENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGS
IRIHNAELQRYILATLLKEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSRSIRD
VIAFPKSFRGHDLMSNTPDSVPPEELKPYHIRVSKPTDSKAERAH
Download sequence
Identical sequences H2R3I4
ENSPTRP00000045565 XP_524974.2.37143 9598.ENSPTRP00000045565 ENSPTRP00000045565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]