SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000046129 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000046129
Domain Number 1 Region: 8-164
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 2.62e-68
Family TRADD, N-terminal domain 0.0000000421
Further Details:      
 
Domain Number 2 Region: 220-304
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000165
Family DEATH domain, DD 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000046129   Gene: ENSPTRG00000008215   Transcript: ENSPTRT00000043080
Sequence length 311
Comment pep:known chromosome:CHIMP2.1.4:16:66425957:66432442:-1 gene:ENSPTRG00000008215 transcript:ENSPTRT00000043080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQ
MLKIHRSDPQLIVQLRFCGRQPCGRFLRAYREGALRAALQRSLAAALAQHSVPLQLELRA
GAERLDALLADEERCLSCILAQQPDRLRDEELAELEDALRNLKCGSGARGGDGEVASAPL
QPPVPSLSEVKPPXRPAAXTFLFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRGC
RALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDL
LGLTDPNGGLA
Download sequence
Identical sequences ENSPTRP00000046129 ENSPTRP00000046129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]