SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000048470 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000048470
Domain Number 1 Region: 8-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.62e-24
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 2 Region: 463-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.96e-24
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 239-296
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.22e-24
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 4 Region: 407-464
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.74e-23
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 5 Region: 351-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.47e-22
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 6 Region: 509-561
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.97e-20
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 7 Region: 295-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.29e-20
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 8 Region: 199-249
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.65e-16
Family Classic zinc finger, C2H2 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000048470   Gene: ENSPTRG00000028870   Transcript: ENSPTRT00000055882
Sequence length 627
Comment pep:known chromosome:CHIMP2.1.4:19:62286210:62299942:1 gene:ENSPTRG00000028870 transcript:ENSPTRT00000055882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMALTDPAQVSVTFDDVAVTFTQEEWGQLDLAQRTLYQEVMLENCGLLVSLGCPVPRPE
LICHLEHEQEPWTRKEDLSQGTCPGDKGKPKSTEPTTCELALSEGISFWGQLTQGASGDS
QLGQPKDQDGFSEMQGECLRPGLDSQKEKLPGKMSPKHDGLGTADSVCSRIIQDQVSLGD
DVHDCDSHGSGKNPIIQEEENIFKCNECEKVFNKKRLLARHERIHSGVKPYECTECGKTF
SKSTYLLQHHMVHTGEKPYKCMECGKAFNRKSHLTQHQRIHSGEKPYKCSECGKAFTHRS
TFVLHNRSHTGEKPFVCKECGKAFRDRPGFIRHYIIHSGENPYECFECGKVFKHRSYLMW
HQQTHTGEKPYECSECGKAFCESAALIHHYVIHTGEKPFECLECGKAFNHRSYLKRHQRI
HTGEKPYVCSECGKAFTHCSTFILHKRAHSGEKPFECKECGKAFSNRADLIRHFSIHTGE
KPYECMECGKAFNRRSGLTRHQRIHSGEKPYECIECGKTFCWSTNLIRHSIIHTGEKPYE
CSECGKAFSRSSSLTQHQRMHTGRNPISVTDVGRPFTSGQTSVNIQELLLGKNFLNVTTE
ENLLQEEASYMASDRTYQRETPQVSSL
Download sequence
Identical sequences H2R5T9
XP_003316751.1.37143 ENSPTRP00000048470 ENSPTRP00000048470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]