SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000048961 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000048961
Domain Number 1 Region: 434-707
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000011
Family Rhodopsin-like 0.026
Further Details:      
 
Domain Number 2 Region: 64-101
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000183
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000048961
Domain Number - Region: 110-141
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000154
Family EGF-type module 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000048961   Gene: ENSPTRG00000010589   Transcript: ENSPTRT00000048886
Sequence length 719
Comment pep:known chromosome:CHIMP2.1.4:19:14674776:14701205:1 gene:ENSPTRG00000010589 transcript:ENSPTRT00000048886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGRVFLAFCVWLTLPGAETQDSRGCARWCPQNSSCVNATACRCSPGFSSFSEIITTPTE
TCDDINECATPSKVSCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDEC
QQNPTLCKSYGTCVNTLGSYTFCEDMTFSTWTPPPGVHSQTLSRFFDKVQDLGRDSKTSS
AEVTIQNVIKLVDELMEAPGDVEALAPPVRHLIATQLLSNLEDIMRILAKSLPKGPFTYV
SPSNTELTLMIQERGDKNVTMGQSNARMKLNWAVAAGAEDPGPAVAGILSIRNMTTLLAN
ASLNLHSKKQAELEEIYESSIRGVQLRRLSAVNSIFLSHNNTKELNSPILFAFSHLESSN
GEAGRDPPAKDVMPGPRQELLCAFWKSDSDRGGHWATEGCQVLGSKNGSTTCQCSHLSSF
AILMAHYDVEDWKLTLITRVGLALSLFCLLLCILTFLLVRPIQGSRTTIHLHLCICLFVG
STIFLAGIENEGGQVGLRCRLVAGLLHYCFLAAFCWMSLEGLELYFLVVRVFQGQGLSTR
WLCLIGYGVPLLIVGVSAAIYSKGYGRPRYCWLDFEQGFLWSFLGPVTFIILCNAVIFVT
TVWKLTQKFSEINPDMKKLKKARALTITAIAQLFLLGCTWVFGLFIFDDRSLVLTYVFTI
LNCLQGAFLYLLHCLLNKKVREEYRKWACLVAGGSKYSEFTSTTSGTGHNQTRALRASD
Download sequence
Identical sequences ENSPTRP00000048961 ENSPTRP00000048961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]