SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000051414 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000051414
Domain Number - Region: 362-409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000718
Family Laminin-type module 0.015
Further Details:      
 
Domain Number - Region: 796-829
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00167
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 275-320
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00885
Family EGF-type module 0.056
Further Details:      
 
Domain Number - Region: 667-712
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0119
Family Laminin-type module 0.026
Further Details:      
 
Domain Number - Region: 232-259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0144
Family Laminin-type module 0.029
Further Details:      
 
Domain Number - Region: 579-622
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0216
Family Laminin-type module 0.05
Further Details:      
 
Domain Number - Region: 446-495
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0221
Family Laminin-type module 0.05
Further Details:      
 
Domain Number - Region: 189-234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0554
Family EGF-type module 0.056
Further Details:      
 
Domain Number - Region: 142-191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0562
Family Laminin-type module 0.061
Further Details:      
 
Domain Number - Region: 318-364
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0647
Family EGF-type module 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000051414   Gene: ENSPTRG00000007189   Transcript: ENSPTRT00000050316
Sequence length 1044
Comment pep:known chromosome:CHIMP2.1.4:15:63361607:63726636:-1 gene:ENSPTRG00000007189 transcript:ENSPTRT00000050316 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLSLTGLIAFSFLQATLALNPEDPNVCSHWESYAVTVQESYAHPFDQIYYTRCTDILNW
FKCTRHRISYKTAYRRGLRTMYRRRSQCCPGYYENGDFCIPLCTEECVHGRCVSPDTCHC
EPGWGGPDCSSGCDSDHWGPHCSNRCQCQNGALCNPITGACVCAAGFRGWRCEELCAPGT
HGKGCQLPCQCRHGASCDPRTGECLCAPGYTGVYCEELCPPGSHGAHCELRCPCQNGGTC
HHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCHHGGQCDHVTGQCHCTAGYMGDR
CQEECPFGSFGFQCSQRCDCHNGGQCSPTTGACECEPGYKGPRCQERLCPEGLHGPGCTL
PCPCDTDNTISCHPVTGACTCQPGWSGHHCNESCPVGYYGDGCQLPCTCQNGADCHSITG
GCTCAPGFMGEVCAVSCAAGTYGPNCSSICSCNNGGTCSPVDGSCTCKEGWQGLDCTLPC
PSGTWGLNCNESCTCANGAACSPIDGSCSCTPGWLGDTCELPCPDGTFGLNCSEHCDCSH
ADGCDPVTGHCCCLAGWTGIHCDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSCECAPGF
RGPLCQRICPPGFYGHGCAQPCPLCVHSSGPCHHISGICECLPGFSGALCNQVCAGGYFG
QDCAQLCSCANNGTCSPIDGSCQCFPGWIGKDCSQACPPGFWGPACFHACSCHNGASCSA
EDGACHCTPGWTGLFCTQRCPAAFFGKDCGRVCQCQNGASCDHISGKCTCRTGFTGQHCE
QRMCPRNLGYGCQQLCECMNNSTCDHVTGTCYCSPGFKGIRCDQAALMMEELNPYTKISP
ALGAERHSVGAVTGIMLLLFLIVVLLGLFAWHRRRQKEKGRDLAPRVSYTPAMRMTSTDY
SLSGACGMDRRQNTYIMDKGFKDYMKESVCSSSTCSLNSSENPYATIKDPPILTCKLPES
SYVEMKSPVHMGSPYTDVPSLSTSNKNIYEVEPTVSVVQEGCGHNSSYIQNAYDLPRNSH
IPGHYDLLPVRQSPANGPSQDKQS
Download sequence
Identical sequences ENSPTRP00000051414 ENSPTRP00000012295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]