SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000057239 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000057239
Domain Number 1 Region: 242-302
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.5e-26
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 2 Region: 8-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.75e-24
Family KRAB domain (Kruppel-associated box) 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000057239   Gene: ENSPTRG00000005652   Transcript: ENSPTRT00000065676
Sequence length 358
Comment pep:known chromosome:CHIMP2.1.4:12:134150729:134210638:1 gene:ENSPTRG00000005652 transcript:ENSPTRT00000065676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAKSLTAWSRTLVTFKDVFVDFTREEWKLLDTAQQIVYRNVMLENYKNLVSLGYQLTKP
DVILRLEKGEEPWLVEREIHQETHPDSETAFEIKSSVSSRSIFKDKQSCDIKMEGMARND
LWYLSLEEVWKCRDQLDKYQENPERHLSIARVLSLPARHTKLTVGMATRVRTASIWVPPL
QERNSSWDRIRKLQGQESILGQGTPGLQPLPGAPRQKQKSRRIEKVLEWLFISQEQPKIT
KSWGPLSFMDVFVDFTWEEWQLLDPAQKCLYRSVMLENYSNLVSLGYQHTKPDIIFKLEQ
GEELCMVQAQVPNQTCPILKAGKSKAKVLAGLVSGEGLLCASKMTPCCCILWRHSLEN
Download sequence
Identical sequences ENSPTRP00000057239 ENSPTRP00000057239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]