SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000058170 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000058170
Domain Number 1 Region: 21-170
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.34e-27
Family Calponin-homology domain, CH-domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000058170   Gene: ENSPTRG00000014219   Transcript: ENSPTRT00000066592
Sequence length 220
Comment pep:known chromosome:CHIMP2.1.4:22:28008736:28009743:1 gene:ENSPTRG00000014219 transcript:ENSPTRT00000066592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADPVAGIAGSAAKSVRPFRSSEAYVEAMKEDLAEWLNALYGLGLPGGGDGFLTGLATGT
TLCQHANAVTEAARALAAARPARGVAFQAHSVVPGSFMARDNVATFIGWCRVELGVPEVL
MFETEDLVLRKNEKSVVLCLLEVARRGARLGLLAPRLVQFEQEIERELRAAPPAPNAPAA
GEDTTETAPAPGTPARGPRMTPSDLRNLDELLQSVLGRCT
Download sequence
Identical sequences ENSPTRP00000058170 ENSPTRP00000058170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]