SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000059197 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000059197
Domain Number 1 Region: 14-90
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.00000000000000131
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000059197   Gene: ENSPTRG00000029302   Transcript: ENSPTRT00000067612
Sequence length 546
Comment pep:novel chromosome:CHIMP2.1.4:18:42941004:42943265:-1 gene:ENSPTRG00000029302 transcript:ENSPTRT00000067612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGSSTLRAVEKLQVRLATKTDPKKLEKYLQKLSALPMTADILAETGIRKTVKRLRKHQ
HVGDFARDLAARWKKLVLVDRNTGPDPQDPEEGASRQRFGEALQDREKAWGFPEIGAAPR
SPSDSPEHRPTAHRTLPGQQRPHPRSPSREPRAERKCPRIAPADSGRYRASPARTTPLPM
PEGSEPAAPGKQPGRSHTHAAQGGHLLGPGCQGQPQGKAVVSHSKGHKSSRRDSAKKLPP
VQESQSERLQAAGAHSAGPKTVPSHAFSELWDLSEAWMQANYDPLSDSDSMISQAKPEAL
SAPKFREEAAFPGRRVNAKMPVYSGSRPACQLQVPTLRQQCVQVLRNNPDALRDVGEVPY
WVLEPVLEGWRPDQLYRRKKDNHALVRETDELRRIHCFQDFKEEKPQENKTWREQYLRLR
DAPEQRLRVMTTNIRSARGNNPNGREAKMICFKSVAKTPYDTSRRQEKSAGDADPENGEI
KPASKPAGSSHTPSSQSSSDGGRDSSSSSSNEHSAPAAKTRKQAAKKLAPLMAKAIRDYK
RRFSRR
Download sequence
Identical sequences ENSPTRP00000059197 ENSPTRP00000059197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]