SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000059240 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000059240
Domain Number 1 Region: 478-591
Classification Level Classification E-value
Superfamily SH2 domain 6.46e-31
Family SH2 domain 0.000000631
Further Details:      
 
Domain Number 2 Region: 163-256
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.45e-28
Family Ras-binding domain, RBD 0.00019
Further Details:      
 
Domain Number 3 Region: 283-414
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000112
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000059240   Gene: ENSPTRG00000019191   Transcript: ENSPTRT00000067656
Sequence length 594
Comment pep:known chromosome:CHIMP2.1.4:7:49277652:49419772:-1 gene:ENSPTRG00000019191 transcript:ENSPTRT00000067656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALAGCPDSFLHHPYYQDKVEQTPRSQQDPAGPGLPAQSDRLANHQEDDVDLEALVNDMN
ASLESLYSACSMQSDTVPLLQNGQHARSQPRASGPPRSVQPQVSPRQRVQRSQPVHILAV
RRLQEEDQQFRTSSLPAIPNPFPELCGPGSPPVLTPGSLPPSQAAAKQDVKVFSEDGTSK
VVEILADMTARDLCQLLVYKSHCVDDNSWTLVEHHPHLGLERCLEDHELVVQVESTMASE
SKFLFRKNYAKYEFFKNPMNFFPEQMVTWCQQSNGSQTQLLQNFLNSSSCPEIQGFLHVK
ELGKKSWKKLYVCLRRSGLYCSTKGTSKEPRHLQLLADLEDSNIFSLIAGRKQYNAPTDH
GLCIKPNKVRNETKELRLLCAEDEQTRTCWMTAFRLLKYGMLLYQNYRIPQQRKALLSPF
STPVRSVSENSLVAMDFSGQTGRVIENPAEAQSAALEEGHAWRKRSTRMNILGSQSPLHP
STLSTVIHRTQHWFHGRISREESHRIIKQQGLVDGLFLLRDSQSNPKAFVLTLCHHQKIK
NFQILPCEDDGQTFFSLDDGNTKFSDLIQLVDFYQLNKGVLPCKLKHHCIRVAL
Download sequence
Identical sequences A0A2I3G1F1 G3QUE8
ENSPTRP00000059240 ENSGGOP00000006350 ENSGGOP00000006350 ENSNLEP00000010190 XP_008961122.1.60992 XP_008961123.1.60992 XP_008961124.1.60992 XP_014201144.1.60992 XP_018886928.1.27298 XP_018886929.1.27298 XP_018886931.1.27298 ENSNLEP00000010190 ENSPTRP00000059240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]