SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000060168 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000060168
Domain Number 1 Region: 126-158
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000000157
Family CCCH zinc finger 0.00022
Further Details:      
 
Domain Number 2 Region: 86-121
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000000262
Family CCCH zinc finger 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000060168   Gene: ENSPTRG00000041756   Transcript: ENSPTRT00000074111
Sequence length 316
Comment pep:novel chromosome:CHIMP2.1.4:2A:43895216:43896601:-1 gene:ENSPTRG00000041756 transcript:ENSPTRT00000074111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDKKAVGTPGRGFLRRHSATAPSPGSCSPKFPGAANGSSCGSAAAGGPTSRHSQFRDRSF
SENGDRSQHLLHLQQQQKGGGGSQINSTRYKTELCRPFEESGTCKYGEKCQFAHGFHELR
SLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNADERRAVGAGDLWASRPKLHHSLSFSG
FPRATISPRAASRLLDSPTSRTPPPALGAEDLRGPRALLVGANNAFAFGPELSSLFAPSA
TLPGGRPSPPFSFQLPRRLSDSPVFDAPPSPPDSLSDRDSYLSGSLSSGSLSGSESPSLD
PGRRLPIFSRLSISDD
Download sequence
Identical sequences ENSPTRP00000060168 ENSPTRP00000060168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]