SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000060490 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000060490
Domain Number 1 Region: 222-461
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.8e-70
Family Nuclear receptor ligand-binding domain 0.000000000375
Further Details:      
 
Domain Number 2 Region: 18-103
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.96e-31
Family Nuclear receptor 0.0000979
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000060490   Gene: ENSPTRG00000021025   Transcript: ENSPTRT00000073389
Sequence length 470
Comment pep:known chromosome:CHIMP2.1.4:9:73190953:73262880:1 gene:ENSPTRG00000021025 transcript:ENSPTRT00000073389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCENQLKTKADATAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQ
RNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKHQQRLQEQRQ
QQSGEAEALARVYSSSISNGLSNLNNETSGTYANGHVIDLPKSEGYYNVDSGQPSPDQSG
LDMTGIKQIKQEPIYDLTSVPNLFTYSSFNNGQLAPGITMTEIDRIAQNIIKSHLETCQY
TMEELHQLAWQTHTYEEIKAYQSKSREALWQQCAIQITHAIQYVVEFAKRITGFMELCQN
DQILLLKSGCLEVVLVRMCRAFNPLNNTVLFEGKYGGMQMFKALGSDDLVNEAFDFAKNL
CSLQLTEEEIALFSSAVLISPDRAWLIEPRKVQKLQEKIYFALQHVIQKNHLDDETLAKL
IAKIPTITAVCNLHGEKLQVFKQSHPEIVNTLFPPLYKELFNPDCATGCK
Download sequence
Identical sequences A0A1L4FMK7 A0A2I2Z4J0 A0A2I3MFE2 A0A2K5JIH9 A0A2K5ZNM2 A0A2K6DSR4 A0A2K6MF89 A0A2K6T5Y1 F7GZT4 G7PSJ8 Q92753
ENSPTRP00000060490 ENSP00000379507 ENSPTRP00000060490 XP_011802414.1.43180 XP_011823640.1.47321 XP_017711273.1.44346 ENSP00000379507 ENSGGOP00000011683 ENSP00000379507 ENSGGOP00000011683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]